PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27925.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 310aa    MW: 36001.4 Da    PI: 9.1091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27925.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.72e-48401711128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                lppGfrF Pt+eelv++yL++k+++k+ e+++vik +diy++ePwdLpk     +++++++w+fF++r++++a+g r+nr+t+sgyWkatg+   v+s++
  PK27925.1  40 LPPGFRFYPTEEELVSFYLRNKLDSKREEVNRVIKVIDIYSIEPWDLPKhsgeLCQGDTEQWFFFTPRQEREARGGRPNRTTASGYWKATGSPSYVYSSD 139
                79****************************999***************646654455777**************************************** PP

        NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                ++++g+kkt+vfykg+ap+g+kt+W m+eyr+
  PK27925.1 140 NRVIGVKKTMVFYKGKAPTGRKTKWKMNEYRA 171
                ******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-5031178IPR003441NAC domain
PROSITE profilePS5100548.96240229IPR003441NAC domain
PfamPF023654.5E-2541170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
XQRRPSYGGK QELDTTTLKK LNNNTLKLPI QMTPMHEQEL PPGFRFYPTE EELVSFYLRN  60
KLDSKREEVN RVIKVIDIYS IEPWDLPKHS GELCQGDTEQ WFFFTPRQER EARGGRPNRT  120
TASGYWKATG SPSYVYSSDN RVIGVKKTMV FYKGKAPTGR KTKWKMNEYR AIEEVNSSNN  180
ITTPTVMYSY ITILTMKHLP YLIVADHLYH VILSFQLRHE FSLCRVYIIS GSFRAFDRRP  240
TELTRVIREQ QRDEAGPSNQ NAAMIERAQS SSATSSSGEL VDNPMAGGSS TDWEMNQQPL  300
WDLWEQFNWP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-35281734144NO APICAL MERISTEM PROTEIN
1ut4_B1e-35281734144NO APICAL MERISTEM PROTEIN
1ut7_A1e-35281734144NO APICAL MERISTEM PROTEIN
1ut7_B1e-35281734144NO APICAL MERISTEM PROTEIN
3swm_A1e-35281737147NAC domain-containing protein 19
3swm_B1e-35281737147NAC domain-containing protein 19
3swm_C1e-35281737147NAC domain-containing protein 19
3swm_D1e-35281737147NAC domain-containing protein 19
3swp_A1e-35281737147NAC domain-containing protein 19
3swp_B1e-35281737147NAC domain-containing protein 19
3swp_C1e-35281737147NAC domain-containing protein 19
3swp_D1e-35281737147NAC domain-containing protein 19
3ulx_A2e-353717012139Stress-induced transcription factor NAC1
4dul_A1e-35281734144NAC domain-containing protein 19
4dul_B1e-35281734144NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872891.11e-122PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR34e-83NAC90_ARATH; NAC domain-containing protein 90
TrEMBLW9RGY61e-121W9RGY6_9R
STRINGGLYMA12G31150.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-82NAC domain containing protein 90